DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and CHIP

DIOPT Version :10

Sequence 1:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_566305.1 Gene:CHIP / 819925 AraportID:AT3G07370 Length:278 Species:Arabidopsis thaliana


Alignment Length:137 Identity:37/137 - (27%)
Similarity:63/137 - (45%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ALAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALV 178
            |:||.:|.:||...|:.::..|:..|..|||..|..|.::.|||..|::..:..:...||:.|:.
plant     8 AMAERLKEDGNNCFKKERFGAAIDAYTEAIALSPNVPAYWTNRALCHMKRKDWTKVEEDCRKAIQ 72

  Fly   179 YNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRLRED 243
            ..:|..||:..||:|......|....:...:|::|                .|...| ||.:.|:
plant    73 LVHNSVKAHYMLGLALLQKKEFTNGVKELQRALDL----------------GRCSNP-TGYMVEE 120

  Fly   244 LINMLSQ 250
            :...||:
plant   121 IWEELSK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 30/116 (26%)
TPR repeat 116..144 CDD:276809 9/27 (33%)
TPR repeat 149..179 CDD:276809 8/29 (28%)
TPR repeat 184..212 CDD:276809 7/27 (26%)
CHIPNP_566305.1 TPR repeat 10..38 CDD:276809 9/27 (33%)
NrfG 17..125 CDD:443378 31/124 (25%)
TPR repeat 43..73 CDD:276809 8/29 (28%)
TPR repeat 78..106 CDD:276809 7/27 (26%)
TPR repeat 119..143 CDD:276809 3/9 (33%)
RING-Ubox_CHIP 200..270 CDD:438316
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.