DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and TPR10

DIOPT Version :10

Sequence 1:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001189808.1 Gene:TPR10 / 819629 AraportID:AT3G04710 Length:680 Species:Arabidopsis thaliana


Alignment Length:122 Identity:36/122 - (29%)
Similarity:61/122 - (50%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NPESLALAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDC 173
            :||:.|.|...|..|........:..|:..|.:||.|||.:...:.||:...:|||:.|.|::|.
plant   545 SPEAKAKAAEAKARGQDAFHRKDFQMAIDAYTQAIDFDPTDHTLFSNRSLCWLRLGQAEHALSDA 609

  Fly   174 KSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNA 230
            |:....|.::.|...|.|.|...:..|::|..|:.:.:.|.|::   |..::|.|.|
plant   610 KACRELNPDWPKGCFREGAALRLLQRFDEAANAFYEGVLLSPES---KELIDAFREA 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 33/115 (29%)
TPR repeat 116..144 CDD:276809 6/27 (22%)
TPR repeat 149..179 CDD:276809 9/29 (31%)
TPR repeat 184..212 CDD:276809 7/27 (26%)
TPR10NP_001189808.1 DUF1685 82..>125 CDD:462321
ANKYR 232..495 CDD:440430
ANK repeat 282..310 CDD:293786
ANK repeat 313..343 CDD:293786
ANK repeat 345..376 CDD:293786
ANK repeat 378..407 CDD:293786
ANK repeat 410..441 CDD:293786
ANK repeat 442..473 CDD:293786
PLN03088 558..>652 CDD:215568 26/93 (28%)
TPR repeat 585..615 CDD:276809 9/29 (31%)
TPR repeat 620..645 CDD:276809 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.