| Sequence 1: | NP_001246058.1 | Gene: | Sgt / 35052 | FlyBaseID: | FBgn0032640 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001278084.1 | Gene: | Tomm34 / 67145 | MGIID: | 1914395 | Length: | 309 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 57/252 - (22%) |
|---|---|---|---|
| Similarity: | 107/252 - (42%) | Gaps: | 60/252 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 QSFVRSFIDY---LKKQGDVMSPDQTESIEVAIQCLQAAFD-LGDD-------VEAAPAAAGEEQ 60
Fly 61 ATTQSSS---TASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESLALAESIKNE 122
Fly 123 GNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYNNNYSKAY 187
Fly 188 CRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRLREDL 244 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sgt | NP_001246058.1 | SGTA_dimer | 9..>48 | CDD:293154 | 10/42 (24%) |
| TPR_11 | 116..177 | CDD:290150 | 19/60 (32%) | ||
| TPR_2 | 116..149 | CDD:285020 | 9/32 (28%) | ||
| TPR repeat | 116..144 | CDD:276809 | 9/27 (33%) | ||
| TPR_17 | 139..170 | CDD:290167 | 7/30 (23%) | ||
| TPR repeat | 149..179 | CDD:276809 | 12/29 (41%) | ||
| TPR_16 | 156..218 | CDD:290168 | 17/61 (28%) | ||
| TPR_1 | 184..217 | CDD:278916 | 7/32 (22%) | ||
| TPR repeat | 184..212 | CDD:276809 | 5/27 (19%) | ||
| Tomm34 | NP_001278084.1 | TPR 3 | 85..118 | 3/18 (17%) | |
| TPR repeat | 85..113 | CDD:276809 | 2/13 (15%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..189 | 8/38 (21%) | |||
| TPR_11 | 192..257 | CDD:290150 | 22/71 (31%) | ||
| TPR 4 | 193..226 | 9/32 (28%) | |||
| TPR repeat | 193..221 | CDD:276809 | 9/27 (33%) | ||
| TPR repeat | 226..256 | CDD:276809 | 12/29 (41%) | ||
| TPR 5 | 227..260 | 12/32 (38%) | |||
| TPR_1 | 229..260 | CDD:278916 | 12/30 (40%) | ||
| TPR 6 | 261..294 | 7/47 (15%) | |||
| TPR 1 | 9..42 | ||||
| TPR repeat | 9..37 | CDD:276809 | |||
| TPR_11 | 10..82 | CDD:290150 | |||
| TPR_11 | 50..115 | CDD:290150 | 3/15 (20%) | ||
| TPR repeat | 50..80 | CDD:276809 | |||
| TPR 2 | 51..84 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167846132 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||