DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and Ttc1

DIOPT Version :10

Sequence 1:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_650543.1 Gene:Ttc1 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:229 Identity:62/229 - (27%)
Similarity:94/229 - (41%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AAGEEQATTQSSSTASAPD--------------DDAVASGSAGIGAAAAAVPNNIDMFELFQSLY 105
            |.|||....:::||..:..              ||....|:|  |..:.|.|..:|. ||.....
  Fly    14 AIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAA--GGDSIATPTTVDS-ELTIEEL 75

  Fly   106 TER----NPESLAL----AESIKNEGNRLMKENKYNEALLQYNRAIAFDP-----KNPIFYCNRA 157
            .||    :||.|..    |:.:|.|||.|.|.:....|...|..|:...|     :..:.|.|||
  Fly    76 REREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRA 140

  Fly   158 AAHIRLGENERAVTDCKSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKS 222
            ||.|:|..|:.|:.||..|:.....|.:...|....|......::|.:.|.|..|::|..:..:.
  Fly   141 AAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQEARE 205

  Fly   223 ---NLEAARNARNQPPQTGRLR--EDLINMLSQP 251
               .|....|.||:..:...:.  :||.||:.:|
  Fly   206 AQIRLPPIINERNEKLKNEMMSSLKDLGNMILKP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 35/124 (28%)
TPR repeat 116..144 CDD:276809 10/27 (37%)
TPR repeat 149..179 CDD:276809 13/29 (45%)
TPR repeat 184..212 CDD:276809 5/27 (19%)
Ttc1NP_650543.1 3a0801s09 16..>232 CDD:273380 56/218 (26%)
TPR repeat 94..122 CDD:276809 10/27 (37%)
TPR repeat 132..162 CDD:276809 13/29 (45%)
TPR repeat 167..195 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.