DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and CG14894

DIOPT Version :9

Sequence 1:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:229 Identity:62/229 - (27%)
Similarity:94/229 - (41%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AAGEEQATTQSSSTASAPD--------------DDAVASGSAGIGAAAAAVPNNIDMFELFQSLY 105
            |.|||....:::||..:..              ||....|:|  |..:.|.|..:|. ||.....
  Fly    14 AIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAA--GGDSIATPTTVDS-ELTIEEL 75

  Fly   106 TER----NPESLAL----AESIKNEGNRLMKENKYNEALLQYNRAIAFDP-----KNPIFYCNRA 157
            .||    :||.|..    |:.:|.|||.|.|.:....|...|..|:...|     :..:.|.|||
  Fly    76 REREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRA 140

  Fly   158 AAHIRLGENERAVTDCKSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKS 222
            ||.|:|..|:.|:.||..|:.....|.:...|....|......::|.:.|.|..|::|..:..:.
  Fly   141 AAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQEARE 205

  Fly   223 ---NLEAARNARNQPPQTGRLR--EDLINMLSQP 251
               .|....|.||:..:...:.  :||.||:.:|
  Fly   206 AQIRLPPIINERNEKLKNEMMSSLKDLGNMILKP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154
TPR_11 116..177 CDD:290150 23/65 (35%)
TPR_2 116..149 CDD:285020 11/37 (30%)
TPR repeat 116..144 CDD:276809 10/27 (37%)
TPR_17 139..170 CDD:290167 12/35 (34%)
TPR repeat 149..179 CDD:276809 13/29 (45%)
TPR_16 156..218 CDD:290168 19/61 (31%)
TPR_1 184..217 CDD:278916 7/32 (22%)
TPR repeat 184..212 CDD:276809 5/27 (19%)
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 24/70 (34%)
TPR repeat 94..122 CDD:276809 10/27 (37%)
TPR_11 132..198 CDD:290150 20/65 (31%)
TPR repeat 132..162 CDD:276809 13/29 (45%)
TPR_1 133..166 CDD:278916 13/32 (41%)
TPR 167..198 CDD:197478 6/30 (20%)
TPR repeat 167..195 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.