DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and Ttc33

DIOPT Version :9

Sequence 1:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001099884.1 Gene:Ttc33 / 294774 RGDID:1564042 Length:262 Species:Rattus norvegicus


Alignment Length:194 Identity:45/194 - (23%)
Similarity:86/194 - (44%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GEE--QATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESL-----A 114
            ||:  :||:|... |.|.|:...|....|....|                 ::|..|:|     .
  Rat    11 GEKVSKATSQQFE-AEAADEKGAAESEDGNWLHA-----------------SKRRKETLQEGCKQ 57

  Fly   115 LAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVY 179
            .::.:|:||..|.:..:|.||:.:::.|:...|::...|..::...:.|.|...||...:.|:..
  Rat    58 RSKQLKDEGAHLAENKRYQEAIRKWDEALQLTPEDATLYEMKSQVLMSLHEMFPAVHAAEMAVKR 122

  Fly   180 NNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDN-EVYKSNLEAARNARNQPPQTGRLRE 242
            |.:..:::..||.|...:|....|.:::..|:.:.|.| |::|.:|..||..:.|.....|:.:
  Rat   123 NPHSWESWQTLGRAQLGLGEIVLAIRSFQVALHIYPMNPEIWKEDLSWARKLQEQQKVAQRIEK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154
TPR_11 116..177 CDD:290150 14/60 (23%)
TPR_2 116..149 CDD:285020 9/32 (28%)
TPR repeat 116..144 CDD:276809 8/27 (30%)
TPR_17 139..170 CDD:290167 5/30 (17%)
TPR repeat 149..179 CDD:276809 6/29 (21%)
TPR_16 156..218 CDD:290168 14/62 (23%)
TPR_1 184..217 CDD:278916 7/32 (22%)
TPR repeat 184..212 CDD:276809 6/27 (22%)
Ttc33NP_001099884.1 TPR repeat 59..87 CDD:276809 8/27 (30%)
YfgC <71..164 CDD:227122 21/92 (23%)
TPR repeat 92..122 CDD:276809 6/29 (21%)
TPR repeat 127..154 CDD:276809 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0553
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.