DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and Ttc12

DIOPT Version :9

Sequence 1:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_766358.1 Gene:Ttc12 / 235330 MGIID:2444588 Length:704 Species:Mus musculus


Alignment Length:194 Identity:53/194 - (27%)
Similarity:95/194 - (48%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ERNPESLALAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVT 171
            :|..|:..||:::|.:||.......|..|:..|:..:.......:.|.|||.|.|:||:.::|:.
Mouse    96 KRRRENRVLADALKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALV 160

  Fly   172 DCKSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPD---------NEV---YKSNL 224
            ||..||..:.|.:|||..:|.|:..:.|:.||::.|.|..|:.|.         |:|   .|::|
Mouse   161 DCDWALKCDENCTKAYFHMGKAHVALKNYSKAKECYQKIEEINPKLKAQVKEHLNQVTLREKADL 225

  Fly   225 E--AARNARNQPPQTGRLREDLINMLSQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIRQQFGG 286
            :  .|:.:.:....|....::|:..||:|....||....|::   |:.:.......|:.:.:||
Mouse   226 QEKEAQESLDSGKNTAVTTKNLLETLSKPGQTPLFYAGGIEI---LTEMMADCTERTLFRTYGG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154
TPR_11 116..177 CDD:290150 18/60 (30%)
TPR_2 116..149 CDD:285020 7/32 (22%)
TPR repeat 116..144 CDD:276809 7/27 (26%)
TPR_17 139..170 CDD:290167 9/30 (30%)
TPR repeat 149..179 CDD:276809 13/29 (45%)
TPR_16 156..218 CDD:290168 24/70 (34%)
TPR_1 184..217 CDD:278916 12/41 (29%)
TPR repeat 184..212 CDD:276809 10/27 (37%)
Ttc12NP_766358.1 TPR_11 105..170 CDD:290150 20/64 (31%)
TPR 1 105..138 7/32 (22%)
TPR repeat 105..133 CDD:276809 7/27 (26%)
TPR repeat 138..168 CDD:276809 13/29 (45%)
TPR 2 139..172 13/32 (41%)
TPR_11 141..204 CDD:290150 25/62 (40%)
TPR_1 142..172 CDD:278916 13/29 (45%)
TPR 3 173..206 12/32 (38%)
TPR repeat 173..198 CDD:276809 9/24 (38%)
TPR_1 174..205 CDD:278916 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.