DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sgt and rpap-3

DIOPT Version :9

Sequence 1:	NP_001246058.1	Gene:	Sgt / 35052	FlyBaseID:	FBgn0032640	Length:	331	Species:	Drosophila melanogaster
Sequence 2:	NP_501282.1	Gene:	rpap-3 / 183187	WormBaseID:	WBGene00016375	Length:	297	Species:	Caenorhabditis elegans

Alignment Length:	123	Identity:	34/123 - (27%)
Similarity:	65/123 - (52%)	Gaps:	3/123 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   111 ESLALAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKS 175
            |...:|:.:|.:||...|:.||::|:..|::::...| :||.:.|||.|.:.......|..||.:
Worm     3 EEKKIAQRLKEQGNEAFKKKKYHKAMTIYSKSLEHWP-DPIVFSNRAQAGLNADLPLLAQIDCTA 66

  Fly   176 ALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIEL--EPDNEVYKSNLEAARNAR 231
            ||..::..:|||.|...|:..:..:|.||:......:.  :|:.|...::|:..:|.:
Worm    67 ALNLDSTAAKAYYRRAQAFKALELYELAERDMKTCFKYSNDPNMERQANDLKGKKNVQ 124

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sgt	NP_001246058.1	SGTA_dimer	9..>48	CDD:293154
		TPR_11	116..177	CDD:290150	19/60 (32%)
		TPR_2	116..149	CDD:285020	10/32 (31%)
		TPR repeat	116..144	CDD:276809	9/27 (33%)
		TPR_17	139..170	CDD:290167	8/30 (27%)
		TPR repeat	149..179	CDD:276809	11/29 (38%)
		TPR_16	156..218	CDD:290168	17/63 (27%)
		TPR_1	184..217	CDD:278916	9/34 (26%)
		TPR repeat	184..212	CDD:276809	8/27 (30%)
rpap-3	NP_501282.1	3a0801s09	2..>98	CDD:273380	30/95 (32%)
		TPR repeat	8..36	CDD:276809	9/27 (33%)
		TPR repeat	40..70	CDD:276809	11/29 (38%)
		TPR repeat	75..103	CDD:276809	8/27 (30%)
		RPAP3_C	180..271	CDD:372776
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910