DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and UNC45B

DIOPT Version :10

Sequence 1:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_775259.1 Gene:UNC45B / 146862 HGNCID:14304 Length:931 Species:Homo sapiens


Alignment Length:157 Identity:37/157 - (23%)
Similarity:67/157 - (42%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPI---FYCNRAAAHIRLGENERAVTDCKSAL 177
            |..:|.||||..:...|..|...|::|:.......:   .|.||||..::.....:|.:|...|:
Human     6 AVQLKEEGNRHFQLQDYKAATNSYSQALKLTKDKALLATLYRNRAACGLKTESYVQAASDASRAI 70

  Fly   178 VYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRLRE 242
            ..|::..||..|...|..::|..::|.:...:...|||.|:.::..|.....:         ::|
Human    71 DINSSDIKALYRRCQALEHLGKLDQAFKDVQRCATLEPRNQNFQEMLRRLNTS---------IQE 126

  Fly   243 DL-INMLSQPMVRNLF-----NNAEID 263
            .| :...:...|:.:|     .|:|.|
Human   127 KLRVQFSTDSRVQKMFEILLDENSEAD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 30/119 (25%)
TPR repeat 116..144 CDD:276809 10/27 (37%)
TPR repeat 149..179 CDD:276809 8/32 (25%)
TPR repeat 184..212 CDD:276809 6/27 (22%)
UNC45BNP_775259.1 TPR repeat 39..72 CDD:276809 8/32 (25%)
TPR 2 43..76 9/32 (28%)
TPR 3 77..110 9/32 (28%)
TPR repeat 77..103 CDD:276809 6/25 (24%)
ARM 1 169..208
armadillo repeat 172..208 CDD:293788
ARM 2 211..250
armadillo repeat 214..245 CDD:293788
UNC45-central 344..489 CDD:432011
ARM 3 751..790
armadillo repeat 754..788 CDD:293788
3a0801s09 <6..>154 CDD:273380 37/157 (24%)
TPR 1 6..39 10/32 (31%)
TPR repeat 6..34 CDD:276809 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.