DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and prss60.1

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:245 Identity:66/245 - (26%)
Similarity:116/245 - (47%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVY---LTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTT 197
            ||.....|.:.|.|:| :..:|   ..|||||:.:.:||||| .:.::....::|    |:..||
Zfish    36 GGVNAFDGSWPWQVSL-HSPIYGGHFCGGSLINSEWVLTAAH-CLPRITTSSLLV----FLGKTT 94

  Fly   198 NEPIQ-YE-ERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRCT 259
            .:.:. || .|.|..|..|..:...:..|::||:.:.:....::.|..:.|.::.:.| .|....
Zfish    95 QQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTSSW 159

  Fly   260 VAGW-DLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICA-RSEINRDFCF 322
            :.|| ::....:.....|:::..:.|:....|     |..||.. .:..::||| ..:..||.|.
Zfish   160 ITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-----NALLGSG-SVTNNMICAGLLQGGRDTCQ 218

  Fly   323 GGGGYALFCSLGDENPHVFEQAGIVAWGMGCGLDL-PGIYTNVAMFRSWI 371
            |..|..:.    .:...|:.|:||.:||.||.... ||:||.|:.::|||
Zfish   219 GDSGGPMV----SKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 63/234 (27%)
Tryp_SPc 147..371 CDD:214473 61/232 (26%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 64/243 (26%)
Tryp_SPc 34..267 CDD:238113 66/245 (27%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.