DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and gzma

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:247 Identity:59/247 - (23%)
Similarity:104/247 - (42%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNED---RIVVRAGEFVMNTTNEPIQYEERV 207
            ||:|::...:.:..||.||..:.:|||||     ..||   .:.|..|...::..:         
Zfish    39 SWMVSIQVNQNHKCGGILIHKEWVLTAAH-----CKEDSYSSVTVLIGSLSLSKGS--------- 89

  Fly   208 VERIVRH-----EGFIFQSGINNVALIFVK-----TPFVLNDRIGVLTLPSRQASFE-GRRCTVA 261
             :||..|     |.|..::..:::.||.:.     .|:         .:|.::...: |.:|.|.
Zfish    90 -QRIAIHNYEIPETFNKKTKKDDIMLIRLSKKVKAKPY---------KIPKKEKDVQPGTKCVVR 144

  Fly   262 GWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICA-RSEINRDFCFGGG 325
            ||.......:.....::.||:.|:||..|     |....||..:...::|| .::.:|..|.|..
Zfish   145 GWGTTDYKGKQASDKLQMLEVLVVDRVQC-----NRYYNRNPVITKDMLCAGNTQQHRGTCLGDS 204

  Fly   326 GYALFCSLGDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFR-SWIYNRI 375
            |..|.|   ::|     ..|:::...||| ...|.:||.::... :|| |:|
Zfish   205 GGPLEC---EKN-----LVGVLSGSHGCGDPKKPTVYTLLSKRHITWI-NKI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 56/242 (23%)
Tryp_SPc 147..371 CDD:214473 54/240 (23%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.