DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and zgc:123295

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:243 Identity:63/243 - (25%)
Similarity:115/243 - (47%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVY---LTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTT 197
            ||:....|.:.|.|:| ....|   ..|||||:...:|:|||...:.:.  .|:|:.|....:.:
Zfish    38 GGQNAGAGSWPWQVSL-QSPTYGGHFCGGSLINKDWVLSAAHCFQDSIG--TIMVKLGLQSQSGS 99

  Fly   198 NEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRCTVA 261
            | |.|..:.||: ::.|..:...|..|::||:.:.:....||.|..:.|.:...:: .|....|.
Zfish   100 N-PYQITKTVVQ-VINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVT 162

  Fly   262 GWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICA--RSEINRDFCFGG 324
            ||..:||.......|::::|:.::..:.|...:..       ::..::|||  ..:..:|.|.|.
Zfish   163 GWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPG-------EITSNMICAGLLDQGGKDSCQGD 220

  Fly   325 GGYALFCSLGDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFRSWI 371
            .|..:....|.:    :.|:|||::|.||. ...||:|..|:.::.||
Zfish   221 SGGPMVSRNGSQ----WIQSGIVSFGRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 60/232 (26%)
Tryp_SPc 147..371 CDD:214473 58/230 (25%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 61/241 (25%)
Tryp_SPc 36..264 CDD:238113 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.