DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and zgc:123217

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:242 Identity:61/242 - (25%)
Similarity:114/242 - (47%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEP 200
            ||.....|.:.|.|::.|...::.||:||..:.::||||..:| .|.:...:..|....:|:...
Zfish    39 GGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCIIN-TNINVWTLYLGRQTQSTSVAN 102

  Fly   201 IQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRCTVAGWD 264
            ....:..::.|:.|..|......|:::|:.:..|...:..|..:.|.:..:.| .|..|...||.
Zfish   103 PNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSIFYNGTSCWATGWG 167

  Fly   265 LVSSHDQS--RMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGY 327
            .:.. ||:  ..:.::::::.|:..:.|..::.:.   .|..:.|.:||| .:.|:..|.|..|.
Zfish   168 NIGK-DQALPAPQTLQQVQIPVVANSLCSTEYESV---NNATITPQMICA-GKANKGTCQGDSGG 227

  Fly   328 ALFCSLGDENPHVFEQAGIVAWG--MGCGLD-LPGIYTNVAMFRSWI 371
            ...|..|.    |:.||||.::|  .||.:. .|.:|:.|:.|:|||
Zfish   228 PFQCKQGS----VWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 58/231 (25%)
Tryp_SPc 147..371 CDD:214473 56/229 (24%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 59/240 (25%)
Tryp_SPc 37..273 CDD:238113 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.