DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG18735

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:126/280 - (45%) Gaps:33/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PDVPITYW--PLKGSGAPTNDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLI 164
            |:|| ..|  |.|...|..:.|     ...|.....||:......|.|::.|.:...:..|.||:
  Fly    55 PEVP-AEWSSPAKRECAECSCG-----NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLV 113

  Fly   165 SPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALI 229
            :.:..||||| .:|......|.||..|.  |..:..::..:|.|.|::.|..:..::..:::|||
  Fly   114 NDQYALTAAH-CVNGFYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175

  Fly   230 FVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSS----HDQSRMRIIKKLELTVLDRTTC 290
            ....|..|...:..:.:|:...::.|:...|.||..:|.    .|     .::::|:.:|.:..|
  Fly   176 RFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISD-----TLQEVEVPILSQEEC 235

  Fly   291 VAQFRNTTLGRNFDLHPSLICAR--SEINRDFCFG-GGGYALFCSLGDENPHVFEQAGIVAWGMG 352
                ||:..|.: .:..::|||.  .:..:|.|.| .||.......||    .::.||||:||.|
  Fly   236 ----RNSNYGES-KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD----AYQLAGIVSWGEG 291

  Fly   353 CGL-DLPGIYTNVAMFRSWI 371
            |.. :.||:||.|..|..||
  Fly   292 CAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 64/233 (27%)
Tryp_SPc 147..371 CDD:214473 62/231 (27%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 65/245 (27%)
Tryp_SPc 83..314 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.