DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Prss21

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:124/272 - (45%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 QAEQPKPT------------ERTQP----GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILT 171
            |.:..||.            .||.|    ||.....|.:.|..:|.....:|.|.:|::.:.:||
Mouse    28 QVDPEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLT 92

  Fly   172 AAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQ-YEERV-VERIVRHEGFIFQSGINNVALIFVKTP 234
            |||......:.....|:.||.....:...:| |..|. :|.|.....:..|.. |::||:.:.:|
Mouse    93 AAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYSEQYP-NDIALLKLSSP 156

  Fly   235 FVLNDRIGVLTLPSRQASFEGRR-CTVAGWDLVSSHDQS--RMRIIKKLELTVLDRTTCVAQFRN 296
            ...|:.|..:.|.:....||.|. |.|.||..: ..|:|  ....::::::.:::.:.|...::.
Mouse   157 VTYNNFIQPICLLNSTYKFENRTDCWVTGWGAI-GEDESLPSPNTLQEVQVAIINNSMCNHMYKK 220

  Fly   297 TTLGRNFDLHPSLICARS-EINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPG 359
            .....|  :...::||.: |..:|.|||..|..|.|    :...|:.|.|:|:||:|||. :.||
Mouse   221 PDFRTN--IWGDMVCAGTPEGGKDACFGDSGGPLAC----DQDTVWYQVGVVSWGIGCGRPNRPG 279

  Fly   360 IYTNVAMFRSWI 371
            :|||::...:||
Mouse   280 VYTNISHHYNWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 63/232 (27%)
Tryp_SPc 147..371 CDD:214473 61/230 (27%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 64/244 (26%)
Tryp_SPc 55..294 CDD:238113 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.