DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:269 Identity:69/269 - (25%)
Similarity:119/269 - (44%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QPKPTERTQPGGRCNTT-GLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRA 189
            :|.||...:..|..|.| |.:.|:|:|.....:..|||||:.:.:|||||..::: ....|:|..
Zfish    27 RPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQ-TPSSIIVYL 90

  Fly   190 GEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF- 253
            |::.....:  :....|.:..|:.|..:...:..|::||:.:.:.....|.|..:.|....::| 
Zfish    91 GKWRSYVAD--VNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFP 153

  Fly   254 EGRRCTVAGWDLVSSHDQSRMR-------------IIKKLELTVLDRTTCVAQFRNTTLGRNFDL 305
            .|....||||..:.......:|             |:::.||.|.....|    .|...||   :
Zfish   154 RGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADC----NNICHGR---I 211

  Fly   306 HPSLICARSEINRDFCFGG--GGYALF-CSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAM 366
            .|::|||.:.......|.|  ||..:. ||       |:.|||:::.|.||.. :||.::..|:.
Zfish   212 TPNMICAGTRPGGKATFSGDSGGPLMTKCS-------VWVQAGVLSHGYGCAQPNLPEVFIRVSE 269

  Fly   367 FRSWIYNRI 375
            ::.||...:
Zfish   270 YKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 62/243 (26%)
Tryp_SPc 147..371 CDD:214473 60/241 (25%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.