DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and zgc:112038

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:245 Identity:67/245 - (27%)
Similarity:118/245 - (48%) Gaps:19/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVAL--FYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTN 198
            ||.....|.:.|..::  ...|.::.|||||:...:|:|||..|.....:..:....:|  .|.:
Zfish    37 GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQF--QTGS 99

  Fly   199 EPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFE-GRRCTVAG 262
            .|.:. .|.:.:||.|..:...:..|::||:.:.:.....|.|..:.|.|..:.|. |.:..:.|
Zfish   100 NPNEI-SRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSWITG 163

  Fly   263 WDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICAR-SEINRDFCFGGGG 326
            ||...|.|.....::::::|.|:..|.|.|.::..       :..::|||. :|..:|.|.|..|
Zfish   164 WDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGI-------ITDNMICAGINEGGKDACQGDSG 221

  Fly   327 YALFCSLGDENPHVFEQAGIVAWGMGCGLD-LPGIYTNVAMFRSWIYNRI 375
            ..:.    .:|...:.|:|||::|..|||. .|||||.|:.::|||.:.:
Zfish   222 GPMV----SQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSEL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 64/230 (28%)
Tryp_SPc 147..371 CDD:214473 62/228 (27%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 65/239 (27%)
Tryp_SPc 37..263 CDD:238113 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.