DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Prss44

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:333 Identity:88/333 - (26%)
Similarity:145/333 - (43%) Gaps:59/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TRPTVSSEPQNNVSTEPDV----------PITYWPLKGSGAPTNDGAQAEQP------------- 127
            |.|::|..|..|...:|.|          |.|..|||..|:.|...:....|             
  Rat    31 TLPSLSPLPSENGLDDPGVNPQERPLTGMPETSLPLKPGGSMTPFDSMGFTPGHSFSSMSLSRQS 95

  Fly   128 -----KPT----ERTQ--PGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMN 181
                 .||    .||.  .||:......:.|.|:|...:.::.||||||...::||||.....::
  Rat    96 FPPWIPPTSACGHRTARIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGHLD 160

  Fly   182 EDRIVVRAGE---FVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGV 243
               .||..||   :...:...|:|      :.||..:..:.::.::::||:.:..|...:..|..
  Rat   161 ---YVVSMGEADLWSSMSVKIPVQ------DIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQP 216

  Fly   244 LTLPSRQASF---EGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDL 305
            :.:|.:  ||   .|..|.|.||.......:| .|::::::|:::....|....::.| ||.|.|
  Rat   217 VCIPEK--SFLVQPGTLCWVTGWGKTIERGRS-SRVLREVDLSIIRHERCNQILKDIT-GRIFTL 277

  Fly   306 -HPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFR 368
             ....:|..::...|.|.|..|..:.|    |....:.|.|||:||:||| :..|||||.|:.:|
  Rat   278 VQEGGVCGYNKKGGDACQGDSGGPMVC----EFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYR 338

  Fly   369 SWIYNRIA 376
            .||...::
  Rat   339 DWIIKELS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 67/233 (29%)
Tryp_SPc 147..371 CDD:214473 65/231 (28%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 67/245 (27%)
Tryp_SPc 113..341 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.