DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG11313

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:413 Identity:105/413 - (25%)
Similarity:166/413 - (40%) Gaps:94/413 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AAILLFCVL-----SGE--ACR-------YCVPMEKCLILSRKLNSCPFNHVCCDIIIKSPYIPS 58
            ||:|| |:|     .|:  :||       |||.:..|:         |.|    .::.||.  |:
  Fly     5 AAVLL-CLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCV---------PLN----SVLAKSN--PT 53

  Fly    59 GPNEESDSESASSSTEEENIPTFIYFPTRP--TVSSEPQNNV---STEPDVPITYWPLKGSGAPT 118
            ........||....:::.::|.....|...  |..:.|.:.|   :..||..|.     |.....
  Fly    54 DSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSIC-----GGDIAY 113

  Fly   119 NDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYE-------EVYLTGGSLISPKVILTAAH-- 174
            |...:..:...||             ::|:|.|.|.       ..| ..||||:.:.::||||  
  Fly   114 NQITKGNETVLTE-------------FAWMVLLEYRPHDGQQLRTY-CAGSLINNRYVVTAAHCV 164

  Fly   175 NTMNKMNED----RIVVRAGEF----VMNTTN-----EPIQYEERVVERIVRHEGFIFQSGINNV 226
            :...:..:.    |:.||.||.    |::..|     ||:|.   .||.|..||.|..:...|::
  Fly   165 SAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQI---AVEEIRIHESFGTRLFWNDI 226

  Fly   227 ALIFVKTPFVLNDRIGVLTLPSR---QASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRT 288
            |||.:......:..|..:.|||.   |....|:..|||||....:.:.|.:::  ||.:|.::..
  Fly   227 ALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKM--KLRVTYVEPG 289

  Fly   289 TCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGC 353
            .|..::.:..:     |..|.:||......|.|.|..|..|...    :..|:...|||::|:.|
  Fly   290 LCRRKYASIVV-----LGDSHLCAEGRSRGDSCDGDSGGPLMAF----HEGVWVLGGIVSFGLNC 345

  Fly   354 GLDL-PGIYTNVAMFRSWIYNRI 375
            |... |.:||||..:.:||...|
  Fly   346 GSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 72/251 (29%)
Tryp_SPc 147..371 CDD:214473 70/249 (28%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 14/68 (21%)
Tryp_SPc 116..367 CDD:238113 74/278 (27%)
Tryp_SPc 116..364 CDD:214473 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.