DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG9737

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:108/269 - (40%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFY-EEVYLTGGSLISPKVILTAAHNTMNKMNEDR---IVVRAGEFVMNT 196
            ||.......:.|:..|.| ...|...|:||..:.||||||....:...||   ..||.|||  |.
  Fly   152 GGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEF--NV 214

  Fly   197 TNEPIQYEER------------VVERIVRHEGFIFQSG--INNVALIFVKTPFVLNDRIGVLTLP 247
            ..||...||.            ..|:|..|..:...|.  .|::|:|.:|.|......:..:.||
  Fly   215 KTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICLP 279

  Fly   248 SRQASF---EGRRCTVAGW---DL-----VSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGR 301
            ::....   ||:..:|:||   ||     ::.|...::    ||.:..:....|.....    |.
  Fly   280 NKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKL----KLRIPYVSNENCTKILE----GF 336

  Fly   302 NFDLHPSLICARSEINRDFCFG--GGGYALFCSLGDENPHVFEQAGIVAWGM-GCGL-DLPGIYT 362
            ...|.|..|||..|..:|.|.|  ||....|    |.....:...|:|::|. .||: ..|.:||
  Fly   337 GVRLGPKQICAGGEFAKDTCAGDSGGPLMYF----DRQHSRWVAYGVVSYGFTQCGMAGKPAVYT 397

  Fly   363 NVAMFRSWI 371
            |||.:..||
  Fly   398 NVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 74/258 (29%)
Tryp_SPc 147..371 CDD:214473 72/256 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/267 (28%)
Tryp_SPc 150..409 CDD:238113 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.