DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG31266

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:63/265 - (23%)
Similarity:100/265 - (37%) Gaps:29/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GAPTNDGAQAEQPKPTERTQP----GGRCNTTGLYSWVVALFYEEVY---LTGGSLISPKVILTA 172
            |.|....|..|:.:.||....    ||.....|.:.|:.::  :..|   |.|..::....:|||
  Fly    29 GEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASI--QNAYSYHLCGAIILDETWVLTA 91

  Fly   173 AHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVL 237
            | :.:..:....::|..|.........|..    .|.:|..|..|......|::||:.:.:....
  Fly    92 A-SCVAGLRPLNLLVVTGTVDWWDLYAPYY----TVSQIHVHCNFDKPLYHNDIALLQLSSKIEF 151

  Fly   238 NDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRM-RIIKKLELTVLDRTTCVAQFRNTTLGR 301
            ||....:||.......||.:.|.|||.  ||...... |.:::...|.|....|..:.:|..   
  Fly   152 NDVTKNITLADIDELEEGDKLTFAGWG--SSEAMGTYGRYLQEASGTYLPVDACREKLQNQD--- 211

  Fly   302 NFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGLDLPGIYTNVAM 366
              |:....:|.:.:..:..|.|..|..|.    ||...:   .||..||:.||...|.:|...|.
  Fly   212 --DVDLGHVCVQMDAGQGACHGDTGGPLI----DEQQRL---VGIGNWGVPCGRGYPDVYARTAF 267

  Fly   367 FRSWI 371
            :..||
  Fly   268 YHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 54/229 (24%)
Tryp_SPc 147..371 CDD:214473 52/227 (23%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 55/241 (23%)
Tryp_SPc 52..275 CDD:238113 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.