DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG3916

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:283 Identity:74/283 - (26%)
Similarity:111/283 - (39%) Gaps:79/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 APT--NDGAQAEQPKPTE---RTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHN 175
            :||  |.|.:..:..|.:   :.|..||        |        .:..|||::|.:.:||||| 
  Fly    27 SPTRINGGQRVNETVPFQVSLQMQRRGR--------W--------QHFCGGSIVSGQHVLTAAH- 74

  Fly   176 TMNKMNEDRIVVRAGEFVMNTTN-EPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVL-- 237
            .|.||..:.:.|     |:.|.| :......|:|.:.|..:..:....||::||:.|..||.|  
  Fly    75 CMEKMKVEDVSV-----VVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKVTPPFRLER 134

  Fly   238 ----------NDRIGVLTLPSRQASFEGRRCTVAGWDLVSSH-------DQSRMRIIKKLELTVL 285
                      :||||. .:|.|          :.||...|..       ||     ::.|....:
  Fly   135 SDISTILIGGSDRIGE-KVPVR----------LTGWGSTSPSTSSATLPDQ-----LQALNYRTI 183

  Fly   286 DRTTCVAQ-FRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAW 349
            ....|..: ||.|   ||      .|||.:...:..|.|..|..|.  ...:.||:   .|||::
  Fly   184 SNEDCNQKGFRVT---RN------EICALAVQGQGACVGDSGGPLI--RPGKQPHL---VGIVSY 234

  Fly   350 GMG-CGLDLPGIYTNVAMFRSWI 371
            |.. |....|.:||.|:.|..:|
  Fly   235 GSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 66/247 (27%)
Tryp_SPc 147..371 CDD:214473 65/245 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 71/278 (26%)
Tryp_SPc 31..260 CDD:238113 72/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.