DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG4914

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:399 Identity:107/399 - (26%)
Similarity:156/399 - (39%) Gaps:107/399 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MEKCLILSRKLNSCPFNHVCCDIIIKSPYIP--SGPNEESDSESA-------------------- 69
            |..||:.:...::.|          .:|..|  |.|...|.:.|:                    
  Fly    15 MASCLLFTAATSATP----------ATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAKK 69

  Fly    70 ------SSSTEEENIPTFIYFPTRPTVSSEPQNNVSTEPDVPITYWPLKGSGAPTNDGAQAEQPK 128
                  ::|:.:.|.|.|            .||        ||..|  .|:....|..|...|..
  Fly    70 LKIGDVNASSSDANKPVF------------RQN--------PIKNW--FGAFNRNNSPAAQNQTS 112

  Fly   129 PT------ERTQP----GGRCNTTGL--YSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMN 181
            ||      ||...    ||  .|||:  |.|:..|.|...:..||:||:.:.:|||||.....| 
  Fly   113 PTCSCRCGERNDESRIVGG--TTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFM- 174

  Fly   182 EDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGV--- 243
            ...|.|..||.  :..|:..:.|.|.|.|....: |.|.:..|::||:      .||||:.:   
  Fly   175 WFMIKVTFGEH--DRCNDKERPETRFVLRAFSQK-FSFSNFDNDIALL------RLNDRVPITSF 230

  Fly   244 ---LTLP---SRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQ--FRNTTLG 300
               :.||   .||..|.|.:....||..: ..|.....:::::|:.|||...||||  :....:.
  Fly   231 IRPICLPRVEQRQDLFVGTKAIATGWGTL-KEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMIT 294

  Fly   301 RNFDLHPSLICA--RSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYT 362
            :|      ::|:  .....||.|.|..|..|.....|:..  |||.|||:||.||.. :.||:||
  Fly   295 KN------MMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKR--FEQIGIVSWGNGCARPNYPGVYT 351

  Fly   363 NVAMFRSWI 371
            .|..:..||
  Fly   352 RVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 74/239 (31%)
Tryp_SPc 147..371 CDD:214473 72/237 (30%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 78/253 (31%)
Tryp_SPc 128..363 CDD:238113 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.