DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG4613

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:291 Identity:78/291 - (26%)
Similarity:132/291 - (45%) Gaps:28/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TVSSEPQNNVSTEPDVPITYWPLKGSGAP---TNDGAQAEQPKPTERTQPGGRCNTTGLYSWVVA 150
            |.||....::|:... |:  :||:|.||.   .|..|......|......||....|..|.|:..
  Fly    92 TASSLGSTSLSSSAS-PV--FPLEGGGAKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQ 153

  Fly   151 LFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHE 215
            :........||:||:.:.:||||| .::.|:...:.||..:...::|:..:   .|.|.....|.
  Fly   154 IIRGTFLFCGGTLINDRYVLTAAH-CVHGMDMRGVSVRLLQLDRSSTHLGV---TRSVAFAHAHV 214

  Fly   216 GFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSR-QASFEGRRCTVAGWDLVSSHDQSRMRIIKK 279
            |:...|.::::||:.:..|..|.|.:....|||. ..:|:.::..||||.| |....|...::::
  Fly   215 GYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGL-SQEGGSTSSVLQE 278

  Fly   280 LELTVLDRTTCVA-QFRNTTLGRNFDLHPSLICAR--SEINRDFCFGGGGYALFCSLGDENPHVF 341
            :.:.::....|.| .:|:..:       .:::||.  ....||.|.|..|..|..     ...:|
  Fly   279 VVVPIITNAQCRATSYRSMIV-------DTMMCAGYVKTGGRDACQGDSGGPLIV-----RDRIF 331

  Fly   342 EQAGIVAWGMGCGL-DLPGIYTNVAMFRSWI 371
            ..||:|::|.||.. |.||:||.|:.:..||
  Fly   332 RLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 61/230 (27%)
Tryp_SPc 147..371 CDD:214473 59/228 (26%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 63/242 (26%)
Tryp_SPc 137..362 CDD:238113 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.