DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG18477

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:405 Identity:120/405 - (29%)
Similarity:178/405 - (43%) Gaps:98/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSIVATAAILLF----------------CVLSGEACRYCVPMEKC-------LILSRKLNSCPF 42
            |..|:|..:::|.                |..|.|  ..|||...|       :.::.:...|..
  Fly     4 MYGIIAIVSLILVAGQVQAQGQNAELNQSCGASNE--HQCVPRHMCKVKIEFRMAMTYRNLGCVS 66

  Fly    43 NHVCC--DIIIKSP-YIPSGPNEES-----DSESASSSTEEENIPTFIYFPTRPTVSSEPQNNVS 99
            ..:||  ::|||.| .|.:.|..:.     :|:..:.|..||:                  ..::
  Fly    67 TAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREED------------------TGLA 113

  Fly   100 TEPDVPITYWPLKGSGAPTNDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEV--YLTGGS 162
            .|.:||                                         |:|||.....  |:.||:
  Fly   114 QEAEVP-----------------------------------------WMVALLDARTSSYVAGGA 137

  Fly   163 LISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVA 227
            ||:|.|::||...|.| |...::||||||:..:|..|.:...:..:..||||.||..::|.||||
  Fly   138 LIAPHVVITARQRTEN-MTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVA 201

  Fly   228 LIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVA 292
            |:|::.....:..|..:.:||...:|:..||...||...|..|.|.|.::||:.|.|:.|.||..
  Fly   202 LVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQ 266

  Fly   293 QFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-D 356
            |.| ...|.:|:|..||:||..|..:|.|.|.||..|.|::.| ||..:|.||||.:|:.||| .
  Fly   267 QLR-LYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKD-NPQRYELAGIVNFGVDCGLPG 329

  Fly   357 LPGIYTNVAMFRSWI 371
            :|.:|||||....||
  Fly   330 VPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 93/228 (41%)
Tryp_SPc 147..371 CDD:214473 91/226 (40%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 94/274 (34%)
Tryp_SPc 113..344 CDD:238113 94/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.