DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG5390

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:378 Identity:121/378 - (32%)
Similarity:175/378 - (46%) Gaps:81/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EAC---RYCVPMEKCL----------ILSRKLNS---CP-FNHVCCDIIIKSPYIPSGPNEESDS 66
            ::|   :.|||...|.          |:..:|.:   |. :..:|||:          ||:..| 
  Fly    69 QSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDL----------PNKRKD- 122

  Fly    67 ESASSSTEEENIPTFIYFPTRPT-VSSEPQNNVSTEPDVPITYWPLKGSGAPTNDGAQAEQPKPT 130
                        |.|.:.|..|. ...:..|.|.           .|.:||...:....|.|   
  Fly   123 ------------PIFEFKPDHPEGCGYQNPNGVG-----------FKITGAVNQEAEFGEFP--- 161

  Fly   131 ERTQPGGRCNTTGLYSWVVALFYEE----VYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGE 191
                            |::|:..||    :|..||:||:|.|:|||||...|| ....|||||||
  Fly   162 ----------------WMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNK-QPSSIVVRAGE 209

  Fly   192 FVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGR 256
            :...|..|..::|:|.|:.|:.||.|...|..|:||::.:::||.|.:.|..:.||:....|:..
  Fly   210 WDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFD 274

  Fly   257 RCTVAGWDLVS-SHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDF 320
            ||...||.... ..|.....|:||:::.|:....|....|.|.|||:|.||.|.|||..|.::|.
  Fly   275 RCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDT 339

  Fly   321 CFGGGGYALFCSL-GDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFRSWI 371
            |.|.||..|.|.: |.:|.  |:.|||||||:||| :::||:|.:||..|.||
  Fly   340 CKGDGGSPLVCPIAGQKNR--FKSAGIVAWGIGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 96/232 (41%)
Tryp_SPc 147..371 CDD:214473 94/230 (41%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 98/260 (38%)
Tryp_SPc 153..390 CDD:214473 96/258 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.