DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG18557

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:321 Identity:94/321 - (29%)
Similarity:149/321 - (46%) Gaps:61/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YWPLKGSGAPTNDGAQAE------------------QPKPTERTQP---------------GGRC 139
            :|.|..:|||.  |.|.|                  .|.|.:|::.               .|:.
  Fly    12 FWTLTETGAPC--GLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLNCGKS 74

  Fly   140 NTTGL---------------YSWVVALFYEEVYLTG-GSLISPKVILTAAHNTMNKMNEDRIVVR 188
            |..||               :.|.|||....:...| |:|::..:::||||..::|...|..::.
  Fly    75 NPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIG 139

  Fly   189 AGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF 253
            ....:.....:.||:  |...|||.|..|...:|.||:|||.::|.||:...||.:..|:...||
  Fly   140 GAWDLKQLAGKTIQW--RTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSF 202

  Fly   254 EGRRCTVAGW---DLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSE 315
            :..||.||||   |.::.:...:.   ||::|.::.|:.|.:..|.|...::|.|.|:::||..|
  Fly   203 DRERCLVAGWGRPDFLAKNYSYKQ---KKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGE 264

  Fly   316 INRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGLD-LPGIYTNVAMFRSWIYNRI 375
            ..||.|.|.||..|.|.: ..:|.::|..|||..|..|||: :|.:|||::..|.||..::
  Fly   265 RGRDACIGDGGSPLMCPI-PGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 79/230 (34%)
Tryp_SPc 147..371 CDD:214473 77/228 (34%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 79/240 (33%)
Tryp_SPc 90..320 CDD:214473 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.