DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Ser6

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:95/223 - (42%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GGSLISPKVILTAAHNTMNK--------MNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEG 216
            |||:::...||||||...|:        :..:|..:|||.....:....:|    |.|.||..| 
  Fly    58 GGSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQ----VAEVIVHEE- 117

  Fly   217 FIFQSGINNVALIFVKTPFVLNDRIGVLTLPS--RQASFEGRRCTVAGWDLVSSHDQSRMRIIKK 279
              :.:.:|:|||:.:::|.:|:..|..:.||:  ..|..:   ..::||..: .|.....|.::.
  Fly   118 --YGNFLNDVALLRLESPLILSASIQPIDLPTVDTPADVD---VVISGWGRI-KHQGDLPRYLQY 176

  Fly   280 LELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFG-GGGYALFCSLGDENPHVFEQ 343
            ..|..:.|..|     ...:...|:   ..:|...:::...|.| .||.|::      |..:...
  Fly   177 NTLKSITRQQC-----EELIDFGFE---GELCLLHQVDNGACNGDSGGPAVY------NNQLVGV 227

  Fly   344 AGIVAWGMGCGLDLPGIYTNVAMFRSWI 371
            ||.|.  .|||...|..|..|..|:.||
  Fly   228 AGFVV--DGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 57/223 (26%)
Tryp_SPc 147..371 CDD:214473 55/221 (25%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 55/221 (25%)
Tryp_SPc 32..256 CDD:238113 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.