DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG9676

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:267 Identity:57/267 - (21%)
Similarity:107/267 - (40%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAH-----NTMNKM 180
            |..|:.....|....||.....|.:...::|.....:..|||:||...::||||     |.:...
  Fly    15 GVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPA 79

  Fly   181 NEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLT 245
            ||  :.::||..::::....:.     |..:..|..  :.|..::||::.::.....|..|..:.
  Fly    80 NE--LEIQAGSLLLSSGGVRVP-----VATVTVHPN--YNSNGHDVAVLRLRNSLTFNSNIAAIK 135

  Fly   246 L----PSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTC----VAQFRNTTLGRN 302
            |    |...|:.:     ::||..:|........:: .:::..|.|.:|    :.|...||:.. 
  Fly   136 LATEDPPNDATVD-----ISGWGAISQRGPISNSLL-YVQVKALSRESCQKTYLRQLPETTMCL- 193

  Fly   303 FDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFE--QAGIVAWGM-GCGLDLPGIYTNV 364
              |||.        ::..|:|..|          .|..::  ..|:.::.: |||...|..|..|
  Fly   194 --LHPK--------DKGACYGDSG----------GPATYQGKLVGLASFVIGGCGRAAPDGYERV 238

  Fly   365 AMFRSWI 371
            :..|:||
  Fly   239 SKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 51/241 (21%)
Tryp_SPc 147..371 CDD:214473 49/239 (21%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 52/253 (21%)
Tryp_SPc 28..248 CDD:238113 54/254 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.