DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG31827

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:270 Identity:104/270 - (38%)
Similarity:146/270 - (54%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSGAPTNDGAQAE------QPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILT 171
            |.|.|  |..:.:      |.||.|             :.|.:|:.:....:.|||||:|.::||
  Fly    32 GYGNP--DAVKVQFNVTEGQAKPAE-------------FPWTIAVIHNRSLVGGGSLITPDIVLT 81

  Fly   172 AAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFV 236
            |||...||..|| |||.|||:...:..|...:||..|.::|.|:.|.:|.|.||:||:|:...|.
  Fly    82 AAHRIFNKDVED-IVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFP 145

  Fly   237 LNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGR 301
            |..:|..:.||:::.|....||.||||......|.....::||::|.::.|..|..|.|.|.||:
  Fly   146 LTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQ 210

  Fly   302 NFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGC-GLDLPGIYTNVA 365
            |:.|...||||..|.:.|.|.|.||.||||.: .|:|..|||.|||.||:|| ..::|..||:|.
  Fly   211 NYTLPRGLICAGGEKDNDACTGDGGGALFCPM-TEDPKQFEQIGIVNWGVGCKEKNVPATYTDVF 274

  Fly   366 MFRSWIYNRI 375
            .|:.||..:|
  Fly   275 EFKPWIVQQI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 95/226 (42%)
Tryp_SPc 147..371 CDD:214473 93/224 (42%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 98/247 (40%)
Tryp_SPc 50..280 CDD:214473 96/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.