DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG33127

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:100/236 - (42%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YLTGGSLISPKVILTAAH--NTMNKMNEDRI--VVRAGEFVMNTTNEPIQYEERVVERIVRHEGF 217
            :|.|.|:|..:.:|||||  :.:...|.|.:  .|.||  ::|.:|.... :.|.|:....|..|
  Fly    68 HLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG--IINRSNVTAA-QVRYVDFASTHRSF 129

  Fly   218 IFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLEL 282
            ...:|.:|:||:.|...|..|.|:..:.||.....:..:.....||.|.........:.::....
  Fly   130 NGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFA 194

  Fly   283 TVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVF------ 341
            .:|:.|.|     ...|..:..|....:|::.:.    |:|.||          .|.::      
  Fly   195 PLLNSTGC-----KELLPADAPLTAQQVCSQVKT----CYGDGG----------TPLIYWPITGP 240

  Fly   342 -EQAGIVAWG-MGCG-LDLPGIYTNVAMFRSWIYNRI-AYF 378
             |..|:.:|. |.|| .:.|.:||:|..:..||:..| ||:
  Fly   241 AELVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTIGAYY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 56/228 (25%)
Tryp_SPc 147..371 CDD:214473 54/226 (24%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 56/229 (24%)
Tryp_SPc 41..273 CDD:214473 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.