DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:252 Identity:68/252 - (26%)
Similarity:119/252 - (47%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVAL---FYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGE-FVMNT 196
            |||..:...:.|.|:|   |...::..|||||.|:.:|||||..       .:.:::.| |.:..
  Rat    32 GGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-------GLHIKSPELFRVQL 89

  Fly   197 TNEPIQYEERV--VERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRC 258
            ..:.:.|.:::  |.|.|.|..:.......::||:.::.|..::..|...:||....:| .|..|
  Rat    90 REQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSC 154

  Fly   259 TVAGW-DLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFD---LHPSLICARSEINRD 319
            .|.|| |:.|.........:|::::.:::.:.|..:: :|.|....|   :...::|| .....|
  Rat   155 WVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKY-HTGLYTGDDVPIVQDGMLCA-GNTRSD 217

  Fly   320 FCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMFRSWIYNRI 375
            .|.|..|..|.|.:    ...:.|||:|:||.||. .:.|||||.|..:..||:..:
  Rat   218 SCQGDSGGPLVCKV----KGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 65/237 (27%)
Tryp_SPc 147..371 CDD:214473 63/235 (27%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 68/248 (27%)
Tryp_SPc 30..266 CDD:214473 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.