DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Prss34

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:286 Identity:79/286 - (27%)
Similarity:137/286 - (47%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PLKGSGAP-TNDGAQAEQPKPTERTQPGGRCN-TTGLYSWVVAL-FY-----EEVYLTGGSLISP 166
            |..||..| |.|..|       |.....|.|. :...:.|.|:| ||     :..::.|||||.|
  Rat    14 PCLGSTMPLTPDSGQ-------ELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHP 71

  Fly   167 KVILTAAHNT-MNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGF---IFQSGINNVA 227
            :.:|||||.. :.:|......|:.|:..:...::.::     |.:|:||..|   :...|..::|
  Rat    72 QWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMK-----VAKIIRHPKFSEKLSAPGGADIA 131

  Fly   228 LIFVKTPFVLNDRIGVLTLPSRQASFEGRRC-TVAGWDLVSSHDQSRMRI-IKKLELTVLDRTTC 290
            |:.:.:..||::|:..::||:.......::. .||||.::..|....... ::::.:.::..:.|
  Rat   132 LLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDC 196

  Fly   291 VAQFRN-TTLGRNFD-LHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGC 353
            ..::|. ::|.|... :...::||..| .||.|....|..|.|.....    :.|.|:|:||:||
  Rat   197 EQKYRTYSSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCRWNCS----WVQVGVVSWGIGC 256

  Fly   354 GL-DLPGIYTNVAMFRSWIYNRIAYF 378
            || |.||:||.|..:.|||:..:..|
  Rat   257 GLPDFPGVYTRVMSYLSWIHGYVPKF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 68/240 (28%)
Tryp_SPc 147..371 CDD:214473 66/238 (28%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 69/252 (27%)
Tryp_SPc 33..275 CDD:214473 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.