DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Prss30

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:253 Identity:71/253 - (28%)
Similarity:118/253 - (46%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYE-EVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNE 199
            ||:....|.:.|.|:|..| |.::.|||||....:|||||.....:|.....|:.|...::.| |
  Rat    33 GGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSLT-E 96

  Fly   200 PIQYEERVVERIVRHEGFIF------QSGINNVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRR 257
            |  :...|..|.:    |::      .:...::||:.:.|| :...:...:.||..||.. .|..
  Rat    97 P--HSTLVAVRNI----FVYPTYLWEDASSGDIALLRLDTP-LQPSQFSPVCLPQAQAPLTPGTV 154

  Fly   258 CTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFR--NTTLGRNFDLHPSLICAR-SEINRD 319
            |.|.||.  ::|::....::::|.:.:||...|...:.  .|:|.....:...::||. .|..:|
  Rat   155 CWVTGWG--ATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKD 217

  Fly   320 FCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWIYNRIA 376
            .|.|..|..|.|::...    :.|.||.:||:||.. :.||:||.|..:..||...:|
  Rat   218 SCQGDSGGPLVCAINSS----WIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 67/237 (28%)
Tryp_SPc 147..371 CDD:214473 65/235 (28%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.