DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG33225

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:281 Identity:67/281 - (23%)
Similarity:115/281 - (40%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TNDGAQAEQPKPTERTQPGGRCNTTGLYS--WVVALFYEEVYLTGGSLISPKVILTAAHNTMNKM 180
            |||......|....|...|   |....::  |:|.:..|......||||:...:||:|...::..
  Fly    42 TNDCGTTRHPSRIRRVVGG---NDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLP 103

  Fly   181 NEDRIVVRAGEFVMNTTN-------EPIQYEERVVERIVRHEGFIFQSGIN-----NVALIFVKT 233
            .:    |..||:..|.|:       :.|..:::::..         |.|:.     ::||:.:..
  Fly   104 KQ----VILGEYDRNCTSADCTSIRQVIDIDQKIIHG---------QFGLETVKKYDIALLRLAK 155

  Fly   234 PFVLNDRIGVLTLP-SRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNT 297
            ...::|.:..:.|. .||.....:..|..||.....::.|  .|::.:.|:.::|..|..:.|  
  Fly   156 KVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPS--TILQTVTLSKINRKYCKGRLR-- 216

  Fly   298 TLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSL---GDENPHVFEQA---GIVAWG-MGC-G 354
               :|.|  .|.:|.... .:|.|.|..|..|..:|   ||...:...:|   |||::| ..| |
  Fly   217 ---QNID--ASQLCVGGP-RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG 275

  Fly   355 LDLPGIYTNVAMFRSWIYNRI 375
            :   |:||||..:..||...|
  Fly   276 I---GVYTNVEHYMDWIVRTI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 59/246 (24%)
Tryp_SPc 147..371 CDD:214473 57/244 (23%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 60/261 (23%)
Tryp_SPc 57..292 CDD:238113 61/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.