DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG33226

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:276 Identity:73/276 - (26%)
Similarity:104/276 - (37%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNE- 199
            ||......|:.|:|.:.....:..||||||...:|||||    ..:..|:.||.|.:...|... 
  Fly    49 GGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAH----CHSRYRLKVRFGRYSGITPRYL 109

  Fly   200 -PIQY-----EERVVERIVRHEGFIFQSGINN--VALIFVKTPFVLNDRIGVLTLP--------- 247
             ..||     .|..|:||..|..:   ...:|  :||..:..|.    |..|.|.|         
  Fly   110 CSSQYCSPFGPEIDVKRIFLHSSY---RDYHNYDIALFLLAKPV----RYNVQTRPICVLQTSNK 167

  Fly   248 --SRQ-----ASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDL 305
              .||     |.|     .|.||....|  |....|::...|..|||..| ||..:..:|     
  Fly   168 DKLRQFLNYVAMF-----NVTGWGKTES--QLTSTILQTTSLFHLDRKFC-AQIFDRKIG----- 219

  Fly   306 HPSLICARSEINRDFCFGGGGYALFCSL---GDENPHVFEQAGIVAWGMGCGLDLPG-----IYT 362
            .|.:....|:.:.  |.|..|..|...|   |.:...:|   ||:::|      .|.     ::|
  Fly   220 WPHICAGHSQSST--CTGDSGGPLSAELTFSGVKRTVLF---GIISYG------APNCREVTVFT 273

  Fly   363 NVAMFRSWIYNRIAYF 378
            ||..:.:||.:.:..|
  Fly   274 NVLRYSNWIRDIVHNF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 69/258 (27%)
Tryp_SPc 147..371 CDD:214473 67/256 (26%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/270 (27%)
Tryp_SPc 47..282 CDD:214473 70/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.