DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Tpsg1

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:312 Identity:89/312 - (28%)
Similarity:147/312 - (47%) Gaps:46/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TFIYFPTRPTVSSEPQ------NNVSTEPDVPITYWPLKGSGAP--TNDGAQAEQPKPTERTQPG 136
            :|.:..::||||:..|      |:||:.          .|.|.|  :|.|::.          .|
Mouse    45 SFQWATSKPTVSARGQYPDSLANSVSSG----------SGCGHPQVSNSGSRI----------VG 89

  Fly   137 GRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPI 201
            |.....|.:.|..:|...:|::.||||:||:.:|||||.....:|.....|..||  :..|..| 
Mouse    90 GHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGE--LTVTLSP- 151

  Fly   202 QYEERVVERIVRHEGFIFQSGIN-NVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRCTVAGWD 264
              ....|:||:.:.|.....|.: ::||:.:.:|..|:.::..:.||...|.| .|.:|.|.||.
Mouse   152 --HFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWG 214

  Fly   265 LVSSHDQSRMRI-IKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYA 328
            .....:..:... :::.:::|:|..|| :|..|:..|..  :.|.::|||..  .|.|....|..
Mouse   215 YTGEGEPLKPPYNLQEAKVSVVDVKTC-SQAYNSPNGSL--IQPDMLCARGP--GDACQDDSGGP 274

  Fly   329 LFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWIYNRIAYFG 379
            |.|.:..    .::|||:|:||.|||. |.||:|..|..:.:||::.|...|
Mouse   275 LVCQVAG----TWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 70/229 (31%)
Tryp_SPc 147..371 CDD:214473 68/227 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.