DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and TPSG1

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:248 Identity:76/248 - (30%)
Similarity:114/248 - (45%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEP 200
            ||.....|.:.|..:|....|::.||||:||:.:|||||.....:|.....|..||  :..|..|
Human    65 GGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGE--LEITLSP 127

  Fly   201 IQYEERVVERIVRHEGFIFQSGIN-NVALIFVKTPFVLNDRIGVLTLPSRQASF-EGRRCTVAGW 263
               ....|.:|:.|.....|.|.: ::||:.:..|..|:.||..:.||.....| .|.||.|.||
Human   128 ---HFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGW 189

  Fly   264 DLVSSHDQ-SRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGY 327
            ......:. .....:::::::|:|..||...:...  |.:. |.|.::|||..  .|.|....|.
Human   190 GYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGP--GGSI-LQPDMLCARGP--GDACQDDSGG 249

  Fly   328 ALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWIYNRIAYFG 379
            .|.|.:..    .:.|||.|:||.|||. :.||:||.|..:.:||...|...|
Human   250 PLVCQVNG----AWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 71/229 (31%)
Tryp_SPc 147..371 CDD:214473 69/227 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 72/238 (30%)
Tryp_SPc 63..293 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.