DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG30289

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:120/294 - (40%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NVSTEPDVPITYWPLKGSGAPTNDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGG 161
            |.....|.|  |.|....||.||     .|..|                 |:|.::..:.  .||
  Fly    29 NCGISKDDP--YVPNIFGGAKTN-----IQENP-----------------WMVLVWSSKP--CGG 67

  Fly   162 SLISPKVILTAAHNTMNKMNEDRIVVRAGE--------FVMNTTNEPIQYEERVVERIVRHEGFI 218
            |||:.:.:|||||    .::.:.:.||.|:        :.:|....|..|...|..:|| ||.: 
  Fly    68 SLIARQFVLTAAH----CVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIV-HENY- 126

  Fly   219 FQSGI---NNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKL 280
              :||   |::||:.:......:|.:..:.|...:........||.||........|  ||:...
  Fly   127 --NGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEYGQFS--RILLNA 187

  Fly   281 ELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAG 345
            .|..:|.:.|..:|       |.....|.|||.|..: :.|.|..|..|.......|..:..|.|
  Fly   188 TLYNMDISYCNIKF-------NKQADRSQICAGSHTS-NTCKGDSGGPLSSKFHYGNRLLSFQYG 244

  Fly   346 IVAWGM-GCGLDLPGIYTNVAMFRSWIYNRIAYF 378
            :|::|. .|..::.|:||||:..|.||:|::..|
  Fly   245 LVSYGSERCAANVAGVYTNVSYHREWIFNKMVQF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 65/237 (27%)
Tryp_SPc 147..371 CDD:214473 63/235 (27%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 69/270 (26%)
Tryp_SPc 42..271 CDD:238113 69/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.