DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG30288

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:272 Identity:77/272 - (28%)
Similarity:106/272 - (38%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYS--WVVALFYEEVYLTGGSLISPKVILTAAH----NTMNKMNEDRIVVRAGEFVM 194
            |||  ..|:.|  |:|.:......:.|||||:.:.:|||.|    ..||        ||.||:  
  Fly    45 GGR--DAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMYMN--------VRLGEY-- 97

  Fly   195 NTTNEPI-----------QYEERVVERIVR-HEGF-----------IFQSGINNVALIFVKTPFV 236
             .|..||           .|...|..:||. :.|:           ||.:.:..:.||..||  :
  Fly    98 -DTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKT--L 159

  Fly   237 LNDRIGVLTLPSRQASFEGRRCTVAGWDLVS-SHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLG 300
            ..:.:.:|            |....||...| ..:|.|   ::...|..|.:.:|...      |
  Fly   160 GGNPLSIL------------RFNFTGWGTNSDGEEQDR---LQTATLQQLPQWSCERP------G 203

  Fly   301 RNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMG-C-GLDLPGIYTN 363
            |..|:  |.|||.|.|: |.|.|..|..|......|......|.|:.:.|:. | ||   |||||
  Fly   204 RPLDI--SYICAGSYIS-DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL---GIYTN 262

  Fly   364 VAMFRSWIYNRI 375
            |..|..||.:.|
  Fly   263 VTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 71/255 (28%)
Tryp_SPc 147..371 CDD:214473 69/253 (27%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 74/266 (28%)
Tryp_SPc 45..270 CDD:238113 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.