DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and CG30083

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:123/283 - (43%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 ITYWPLKGSGAPT-----NDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFY---EEV--YLTG 160
            |..||    ||.:     |.|.....||...     |:....|...|:..:|.   :||  .:.|
  Fly    10 ILLWP----GAMSQFLEPNCGYPDISPKIMH-----GQNAENGTNPWMAYIFKYNDKEVAELVCG 65

  Fly   161 GSLISPKVILTAAHNTMNKMNEDRIV-VRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGIN 224
            |:||..:.:|:|||    .:..|:|: ||.||      :...:|  ..|.:..|::.|...|..|
  Fly    66 GTLIHKQFVLSAAH----CIKRDQILAVRLGE------HSSSRY--FAVTKAFRNKYFTTGSYSN 118

  Fly   225 NVALI----FVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVL 285
            ::.::    .||...|:.. |.::|.|::..:.  :....|||.  .:.:::..:::|.:||..|
  Fly   119 DIGILRIQPIVKFNAVIRP-ICIITDPTKVPNV--KTFKAAGWG--KTENETFSKVLKTVELNEL 178

  Fly   286 DRTTCVAQ-FRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAW 349
            :.:.|... :.|.|        .|.||| ...:.|.|.|..|..|...:..:....:.|.||:::
  Fly   179 NASECYNMLWVNVT--------ESQICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISF 234

  Fly   350 GMG-CGLDLPGIYTNVAMFRSWI 371
            |.. |  :.||:||.::.|..||
  Fly   235 GSSLC--NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 61/237 (26%)
Tryp_SPc 147..371 CDD:214473 59/235 (25%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 62/254 (24%)
Tryp_SPc 34..255 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.