DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:262 Identity:70/262 - (26%)
Similarity:128/262 - (48%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PKPTERTQ--PGGRCNTTGLYSWVVALFYE---EVYLTGGSLISPKVILTAAHNTMNKMNEDRIV 186
            |:|..:..  .||...:...:.|.|:|.::   .::..|||||.|:.:|||||.....:...:: 
Mouse    23 PRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQL- 86

  Fly   187 VRAGEFVMNTTNEPIQYEERV--VERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSR 249
                 |.:....:.:.|.:::  :.|||.|..:....|..:|||:.::.|..::..:..::||..
Mouse    87 -----FRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPA 146

  Fly   250 QASF-EGRRCTVAGW-DLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTL--GRNFDL-HPSL 309
            ..:| .|..|.|.|| |:.:.........:|::::.:::.:.|..:: :|.|  |.:|.: |..:
Mouse   147 SETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKY-HTGLYTGDDFPIVHDGM 210

  Fly   310 ICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWIYN 373
            :|| ....||.|.|..|..|.|.:    ...:.|||:|:||.||.. :.|||||.|..:..||:.
Mouse   211 LCA-GNTRRDSCQGDSGGPLVCKV----KGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHR 270

  Fly   374 RI 375
            .:
Mouse   271 YV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 66/236 (28%)
Tryp_SPc 147..371 CDD:214473 64/234 (27%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.