DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and PRSS21

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:253 Identity:63/253 - (24%)
Similarity:118/253 - (46%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAH--NTMNKMNE-DRIVVRAGEFVMNTT 197
            ||.....|.:.|..:|...:.::.|.||:|.:..|||||  .|.:.::: ...:|:.|:.....:
Human    44 GGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPS 108

  Fly   198 NEPIQ--YEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLPSRQASFEGRR-CT 259
            ...:|  |....|..|.....::..|.. ::||:.:..|......|..:.|.:....||.|. |.
Human   109 FWSLQAYYTRYFVSNIYLSPRYLGNSPY-DIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCW 172

  Fly   260 VAGWDLVSSHDQ-SRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICA-RSEINRDFCF 322
            |.||..:...:. .....::::::.:::.:.|...|...:..:  |:...::|| .::..:|.||
Human   173 VTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRK--DIFGDMVCAGNAQGGKDACF 235

  Fly   323 GGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-DLPGIYTNVAMFRSWIYNRIAYFG 379
            |..|..|.|:...    ::.|.|:|:||:|||. :.||:|||::....||...:|..|
Human   236 GDSGGPLACNKNG----LWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 58/234 (25%)
Tryp_SPc 147..371 CDD:214473 56/232 (24%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.