DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18563 and zgc:165423

DIOPT Version :9

Sequence 1:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:272 Identity:67/272 - (24%)
Similarity:121/272 - (44%) Gaps:24/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TNDGAQAEQPKPTERTQP------GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNT 176
            |....|..|..|.....|      ||...:.|.:.|..:|.....:..||||||.:.||:|||..
Zfish    16 TGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCF 80

  Fly   177 MNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRI 241
            .:..|.....|..|....:..| |.:..:.|.:.|| |..:...:..|::||:.:.:|...::.|
Zfish    81 PSNPNPSDYTVYLGRQSQDLPN-PNEVSKSVSQVIV-HPLYQGSTHDNDMALLHLSSPVTFSNYI 143

  Fly   242 GVLTLPSRQASFEGRRCTVAGWDLVSSH-DQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDL 305
            ..:.|.:..::|......:.||..:.|. .....:|::::.:.::....|     |...|....:
Zfish   144 QPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLC-----NCLYGGGSSI 203

  Fly   306 HPSLICA-RSEINRDFCFG-GGGYALFCSLGDENPHVFEQAGIVAWGMGCG-LDLPGIYTNVAMF 367
            ..:::|| ..:..:|.|.| .||..:..|.     :.:.|||:|::|.||. .:.||:|..|:.:
Zfish   204 TNNMMCAGLMQGGKDSCQGDSGGPMVIKSF-----NTWVQAGVVSFGKGCADPNYPGVYARVSQY 263

  Fly   368 RSWI--YNRIAY 377
            ::||  |.|.::
Zfish   264 QNWISQYVRASF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 57/231 (25%)
Tryp_SPc 147..371 CDD:214473 55/227 (24%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 58/241 (24%)
Tryp_SPc 38..269 CDD:238113 60/242 (25%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.