DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and prss60.1

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:269 Identity:80/269 - (29%)
Similarity:127/269 - (47%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHN---GQYLAGGSLIQPNVVLTVAHRVITIETE 294
            ||::..|. ::|.|:   .|....:||.|:: |:   |.:..|||||....|||.||.:..|.|.
Zfish    25 CGLAPLNN-RIVGGV---NAFDGSWPWQVSL-HSPIYGGHFCGGSLINSEWVLTAAHCLPRITTS 84

  Fly   295 LVVRAGDWDLKSDREIFLSEQR-------EVERAV----IHEGFDFKSGANNLALLFLNSPFKLN 348
            .::            :||.:..       |:.|.|    :|..::..:..|::|||.|:|....:
Zfish    85 SLL------------VFLGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFS 137

  Fly   349 DHIRTICLPTPNKSFA-GRRCTVAGWGKMRY-EDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGA 411
            ::||.:||...|..|. |....:.|||.::. .:.....:|::..:.||..:.|...|.|.    
Zfish   138 NYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSG---- 198

  Fly   412 KFELPKNIICAG---GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYT 473
              .:..|:||||   |  |||||.||.|..:.    .:...|:.|:||.:||.||.....|.:||
Zfish   199 --SVTNNMICAGLLQG--GRDTCQGDSGGPMV----SKQCLVWVQSGITSWGYGCADPYSPGVYT 255

  Fly   474 EVSKFTNWI 482
            .||::.:||
Zfish   256 RVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 75/252 (30%)
Tryp_SPc 252..482 CDD:214473 73/248 (29%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 75/258 (29%)
Tryp_SPc 34..267 CDD:238113 77/259 (30%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.