DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and gzma

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:248 Identity:71/248 - (28%)
Similarity:111/248 - (44%) Gaps:46/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 WAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVVRAGDWDLKSDREIFLSEQREVERAVI 323
            |.|:|..|..:..||.||....|||.||......:.:.|..|.          ||..:..:|..|
Zfish    40 WMVSIQVNQNHKCGGILIHKEWVLTAAHCKEDSYSSVTVLIGS----------LSLSKGSQRIAI 94

  Fly   324 H-----EGFDFKSGANNLALLFLN-----SPFKLNDHIRTICLPTPNKSF-AGRRCTVAGWGKMR 377
            |     |.|:.|:..:::.|:.|:     .|:|         :|...|.. .|.:|.|.|||...
Zfish    95 HNYEIPETFNKKTKKDDIMLIRLSKKVKAKPYK---------IPKKEKDVQPGTKCVVRGWGTTD 150

  Fly   378 YEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGG-ELGRDTCTGDGGSALFC 441
            |:.::.|..|:.:::|||:|..|.::.....:     :.|:::|||. :..|.||.||.|..|.|
Zfish   151 YKGKQASDKLQMLEVLVVDRVQCNRYYNRNPV-----ITKDMLCAGNTQQHRGTCLGDSGGPLEC 210

  Fly   442 SIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSK-FTNWITEKLLPFDYRS 493
                |.:.|    |:::...|||....|.:||.:|| ...|| .|:|...:.|
Zfish   211 ----EKNLV----GVLSGSHGCGDPKKPTVYTLLSKRHITWI-NKILKQQFNS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 68/238 (29%)
Tryp_SPc 252..482 CDD:214473 66/235 (28%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 68/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.