DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and TPSAB1

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:269 Identity:83/269 - (30%)
Similarity:134/269 - (49%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 VGSSELLSPSCGMSNANGLQMVEGITIDQARP-AQYPWAVAIFHNGQY---LAGGSLIQPNVVLT 283
            :.|....:|:.|.:    ||.| ||...|..| :::||.|::..:|.|   ..|||||.|..|||
Human    12 LASRAYAAPAPGQA----LQRV-GIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLT 71

  Fly   284 VAHRV-ITIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKL 347
            .||.| ..::....:|.   .|:.....:..:...|.|.::|..|.......::|||.|..|..:
Human    72 AAHCVGPDVKDLAALRV---QLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNV 133

  Fly   348 NDHIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYST--VLKKVQLLVVNRNVCE-KFLRSTR 408
            :.|:.|:.||..:::| .|..|.|.|||.:. .|:|...  .||:|::.::..::|: |:.....
Human   134 SSHVHTVTLPPASETFPPGMPCWVTGWGDVD-NDERLPPPFPLKQVKVPIMENHICDAKYHLGAY 197

  Fly   409 LGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYT 473
            .|....:.::.:...|...||:|.||.|..|.|.:    :|.:.|||:|:||.||.|...|.|||
Human   198 TGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKV----NGTWLQAGVVSWGEGCAQPNRPGIYT 258

  Fly   474 EVSKFTNWI 482
            .|:.:.:||
Human   259 RVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 75/242 (31%)
Tryp_SPc 252..482 CDD:214473 72/238 (30%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 76/245 (31%)
Tryp_SPc 31..267 CDD:214473 74/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.