DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:123295

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:78/271 - (28%)
Similarity:133/271 - (49%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 NVGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFH--NGQYLAGGSLIQPNVVLTV 284
            |:..|......||.:..| .::|.|   ..|....:||.|::..  .|.:..|||||..:.||:.
Zfish    16 NIAGSLCQLNVCGRAPLN-TKIVGG---QNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSA 76

  Fly   285 AHRVITIETELVVRAGDWDLKSDREIFLSEQREVERAVI----HEGFDFKSGANNLALLFLNSPF 345
            ||........::|:.|   |:|...   |...::.:.|:    |..::..|..|::||:.|:|..
Zfish    77 AHCFQDSIGTIMVKLG---LQSQSG---SNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSV 135

  Fly   346 KLNDHIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRL 409
            ..||:|..:||.....:: ||....|.||||:.....:...:|::|::.:|:.:.|::....   
Zfish   136 TFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPG--- 197

  Fly   410 GAKFELPKNIICAG--GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIY 472
                |:..|:||||  .:.|:|:|.||.|..:.    ..|...:.|:|||::|.||.:.|.|.:|
Zfish   198 ----EITSNMICAGLLDQGGKDSCQGDSGGPMV----SRNGSQWIQSGIVSFGRGCAEPGYPGVY 254

  Fly   473 TEVSKFTNWIT 483
            ..||::.:|||
Zfish   255 ARVSQYQDWIT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 71/243 (29%)
Tryp_SPc 252..482 CDD:214473 68/238 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 70/248 (28%)
Tryp_SPc 36..264 CDD:238113 70/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.