DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and zgc:123217

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:268 Identity:77/268 - (28%)
Similarity:122/268 - (45%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELVV 297
            ||::..| .::|.|   ..|....:||.|:|.:|.:::.||:||....|:|.||.:|.....:  
Zfish    28 CGVAPLN-TRIVGG---TDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCIINTNINV-- 86

  Fly   298 RAGDWDLKSDREIFLSEQRE-------------VERAVIHEGFDFKSGANNLALLFLNSPFKLND 349
                |.|      :|..|.:             ::..:.|..|:.....|:::|:.|:.|...:.
Zfish    87 ----WTL------YLGRQTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSL 141

  Fly   350 HIRTICLPTPNKSF-AGRRCTVAGWGKMRYEDQRYST--VLKKVQLLVVNRNVCEKFLRSTRLGA 411
            :||.|||...|..| .|..|...|||.:. :||....  .|::||:.||..::|.....|..   
Zfish   142 YIRPICLAANNSIFYNGTSCWATGWGNIG-KDQALPAPQTLQQVQIPVVANSLCSTEYESVN--- 202

  Fly   412 KFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWG--VGCGQEGIPAIYTE 474
            ...:...:||| |:..:.||.||.|....|..|    .|:.||||.::|  .||.....|.:|:.
Zfish   203 NATITPQMICA-GKANKGTCQGDSGGPFQCKQG----SVWIQAGITSYGTSAGCAVGAYPDVYSR 262

  Fly   475 VSKFTNWI 482
            ||:|.:||
Zfish   263 VSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 72/251 (29%)
Tryp_SPc 252..482 CDD:214473 70/247 (28%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 72/257 (28%)
Tryp_SPc 37..273 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.