DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG18735

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:139/274 - (50%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SELLSPS------CGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTV 284
            :|..||:      |...|.|....:.|  ..:....:|||.:.:...|.:..|.||:.....||.
  Fly    59 AEWSSPAKRECAECSCGNINTRHRIVG--GQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTA 121

  Fly   285 A-------HRVITIETELVVRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLN 342
            |       ||:||      ||..:.: :.|..:.:.::| |.|.:||..:..::..:::||:..|
  Fly   122 AHCVNGFYHRLIT------VRLLEHN-RQDSHVKIVDRR-VSRVLIHPKYSTRNFDSDIALIRFN 178

  Fly   343 SPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRST 407
            .|.:|...:..:|:|||::::||:...|.|||.:. |....|..|::|::.::::..|    |::
  Fly   179 EPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALS-EGGPISDTLQEVEVPILSQEEC----RNS 238

  Fly   408 RLGAKFELPKNIICAG--GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPA 470
            ..| :.::..|:||||  .:.|:|:|.||.|..:.....|:   .|:.||||:||.||.:...|.
  Fly   239 NYG-ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD---AYQLAGIVSWGEGCAKPNAPG 299

  Fly   471 IYTEVSKFTNWITE 484
            :||.|..|.:||.|
  Fly   300 VYTRVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 73/244 (30%)
Tryp_SPc 252..482 CDD:214473 70/238 (29%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/247 (29%)
Tryp_SPc 83..314 CDD:238113 74/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.