DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPH93 and CG34458

DIOPT Version :9

Sequence 1:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:236 Identity:63/236 - (26%)
Similarity:118/236 - (50%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 ARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIET-ELVVRAGDWDLKSDREIFLSEQ 315
            |.|.|:|..|::..||::..|||||...:::|.||..:.... ::....|..||.:..    .:.
  Fly    38 AAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGN----GQT 98

  Fly   316 REVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAG-RRCTVAGWGKMRYE 379
            ..:.:.:||..::.:|...:::|:.|:||..:...::||.|...:.::|. ....::|:|.:. :
  Fly    99 FNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISGFGAIN-Q 162

  Fly   380 DQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGR-DTCTGDGGSALFCSI 443
            :.:....||..|:.:.:|:.|    .|..:..   |...::|||...|: .:|.||.|..|  ::
  Fly   163 NLQLPNRLKFAQVQLWSRDYC----NSQNIPG---LTDRMVCAGHPSGQVSSCQGDSGGPL--TV 218

  Fly   444 GGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITE 484
            .|      :..|:|:||.|||.:|.||:||.|....:||.:
  Fly   219 DG------KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 63/236 (27%)
Tryp_SPc 252..482 CDD:214473 61/232 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 61/232 (26%)
Tryp_SPc 32..254 CDD:238113 63/236 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.